TGF beta 1/TGFB1 Protein is initially identified as a growth factor that induces the growth of rodent fibroblasts. TGF beta 1/TGFB1 Protein inhibits the cell cycle in the G1 phase. TGF beta 1/TGFB1 is an endogenous factor controlling apoptosis in normal and pathological tissues. TGF beta 1/TGFB1 Protein, Human is a recombinant protein (A279-S390) produced by CHO cells.

TGF beta 1/TGFB1 Protein (transforming growth factor beta 1) is a multifunctional cytokine, which is synthesized by almost all cells. TGF beta 1/TGFB1 Protein has a high ability to bind with TGFbRII.
The sequence of amino acids in TGFb1 proteins from different species is very stable, which leads to the conclusion that in the process of evolution, TGFb has been only slightly altered, and that both in humans and in animals, its function is similar. TGF beta 1/TGFB1 Protein is secreted as an inactive peptide, forming part of a ‘latent complex’ consisting of a mature TGFB1 dimer non-covalently bound to its latency-associated peptide (LAP) and, via LAP, to latent TGFB-binding proteins (LTBPs). Activated TGF beta 1/TGFB1 Protein binds to ubiquitously expressed cell-surface TGFB1 type I receptors (TGFBRI) and type II receptors (TGFBRII), which are transmembrane serine/threonine kinases
TGF beta 1/TGFB1 Protein regulates cell proliferation, growth, differentiation and cells movement. TGFb1 has immunomodulatory effects. TGF beta 1/TGFB1 Protein has profibrogenic effects. TGF beta 1/TGFB1 Protein action can be local and systemic. TGF beta 1/TGFB1 Protein plays a driving role in development, fibrosis and cancer

TGFB1 human (0.2 ng/mL) upregulates LINC00941.
TGF-β1 (0.2 ng/mL) significantly and maximally inhibits the growth of MLE cells
TGF–β1 (5 ng/ml) results in a significant increase in the protein and mRNA levels of IL-6 in HTM cells.

1. The ED₅₀ is <0.2 ng/mL as measured in ability to inhibit the mouse IL-4-dependent proliferation of HT-2 cells. 2. The ability to inhibit the IL-4-dependent proliferation of TF 1 human erythroleukemic cells has an ED₅₀ value of 4-40 pg/mL.

Human

CHO

Tag Free

P01137 (A279-S390)

7040  [NCBI]

ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Approximately 12 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 50 mM NaAc, 50 mM NaCl, pH 5.0 or 50 mM Glycine-HCl, 150 mM NaCl, pH 2.5.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O or diluted with 50 mM Citrate. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.