1.The cell proliferation assay using PHA-activated human peripheral blood lymphocytes has an ED₅₀ value of 50-300 pg/mL.
2. Mouse IL-7RA-Fc can bind Human IL-7-His with an affinity constant of 29.0 nM as determined in BLI assay.
3. Measured in a cell proliferation assay using HT-2 mouse T lymphocyte cells. The ED₅₀ this effect is 1.822 ng/mL, corresponding to a specific activity of 5.489×10⁵ units/mg.

• 
  1.The cell proliferation assay using PHA-activated human peripheral blood lymphocytes has an ED₅₀ value of 50-300 pg/mL. Mouse IL-7RA-Fc can bind Human IL-7-His with an affinity constant of 29.0 nM. 2. Measured in a cell proliferation assay using HT-2 mouse T lymphocyte cells. The ED₅₀ this effect is 1.822 ng/mL, corresponding to a specific activity is 5.489×10⁵ units/mg.

Human

HEK293

C-6*His

P13232 (D26-H177)

3574  [NCBI]

DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH

19-30 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.