1. Measured by its ability to inhibit the proliferation of M1 mouse myeloid leukemia cells.The ED₅₀ for this effect is typically 0.1-0.5 ng/mL. 2. Measured in a cell proliferation assay using M-NFS-60 cells. The ED₅₀ this effect is 69.78 ng/mL, corresponding to a specific activity is 1.4331×10^4 units/mg.

Mouse

HEK293

Tag Free

P09056/NP_032527.1 (S24-F203)

16878  [NCBI]

SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF

Approximately 35.6 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.