1.The cell proliferation assay using MCF7 Human breast cancer cells has an ED₅₀ value of 2-20 ng/mL.
2.Human intestinal organoids (ipsc source) were cultured with Activin A , BMP-4(sample) , EGF , Wnt3a, Noggin, R-spondin 1 and FGF-4 . The organoids showed good morphology.

Human

E. coli

Tag Free

P08620 (S54-L206)

2249  [NCBI]

SLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL

Approximately 16.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, 500 mM NaCl, pH7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.