1. Measured in antiviral assays using L929 cells infected with vesicular stomatitisvirus (VSV) and the ED₅₀ is 3-18 pg/mL.
2. Determined by a cytotoxicity assay using human TF-1 cells. The ED50 this effect is 0.3901 ng/mL, corresponding to a specific activity is 2.563×10^6 units/mg.

• 
  Determined by a cytotoxicity assay using human TF-1 cells. The ED₅₀ for this effect is 0.3901 ng/mL, corresponding to a specific activity is 2.563×10⁶ units/mg.

Mouse

HEK293

Tag Free

P01575 (I22-N182)

15977  [NCBI]

INYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIPMEMTEKMQKSYTAFAIQEMLQNVFLVFRNNFSSTGWNETIVVRLLDELHQQTVFLKTVLEEKQEERLTWEMSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLIIRRLTRNFQN

Approximately 28.28 kDa

Greater than 90% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.