IL-17A is a homodimeric cytokine and plays a critical role in host defense mechanisms against many bacterial and fungal pathogens as well as allergic and autoimmune responses. IL-17A induces the production of antimicrobial peptides, cytokines, chemokines, and matrix metalloproteinases. IL-17A Protein, Human (CHO, His) is a recombinant human IL-17A protein with His tag at the C-terminus and is expressed in CHO cells. It consists of 132 amino acids (G24-A155).

Interleukin-17A (IL-17A), also known as CTLA-8, belongs to the IL-17 cytokine family. IL-17A is expressed in memory Th17 cells and is a product of memory CD4⁺ T cells. IL-17A is also produced by a wide variety of immune cells, including CD8⁺ T cells, γδT cells, natural killer T (NKT) cells, monocytes, and neutrophils.
The human IL-17A shares 63.23% amino acid sequence identity with mouse and 61.90% identity with rat.
IL-17A plays a critical role in host defense mechanisms against many bacterial and fungal pathogens as well as allergic and autoimmune responses. IL-17A induces the production of antimicrobial peptides (defensins and S100 proteins), cytokines (IL-6, G-CSF, and GM-CSF), chemokines (CXCL1, CXCL5, IL-8, CCL2, and CCL7), and matrix metalloproteinases (MMP1, MMP3, and MMP13). IL-17A is detrimental in viral infection through promoting neutrophilic inflammation. IL-17A is a homodimeric cytokine and shares similar biological activities with IL-17F. IL-17A binds to IL-17RA with high affinity, and IL-17RA is required for the biological activity of IL-17A. In tumorigenesis, IL-17A recruits myeloid derived suppressor cells (MDSCs) to dampen anti-tumor immunity. IL-17A also enhances tumor growth in vivo through the induction of IL-6.
IL-17A can be used for the research of autoimmune diseases, infection and cancer.

IL-17A (100 ng/mL; 24 h) inhibits the expression of thymic stromal lymphopoietin (TSLP) in human primary keratinocytes.
IL-17A (0.1–100 ng/mL; 0-24 h) significantly potentiates TNF-α-induced IL-8 protein secretion and gene expression in a concentration- and time-dependent manner.

The ED₅₀ is <10 ng/mL as measured by NHDF cells, corresponding to a specific activity of >1 × 10⁵ units/mg.

Human

CHO

C-His

Q16552 (G24-A155)

3605  [NCBI]

GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVAHHHHHH

14-22 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against PBS.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.